OCL-400 GE545
7Pages

Ceramics – high luminous intensity Features:  size 3,0(L) x 2,0(W) x 1,0(H) mm  circuit substrate: Al2O3 Ceramics  encapsulation: Silicone  color conversion type  devices are ROHS and REACH conform  lead free solderable, soldering pads: gold plated  taped in 8 mm blister tape, cathode to transporting perforation  all devices sorted into luminous intensity classes  taping: face-up (T) Merkmale:  Größe: 3.0 x 2.0 x 1.0 mm  Gehäusematerial: Al2O3 Keramik  Vergussmaterial: Silikon  Type mit Farbkonversion  Bauteile sind ROHS und REACH konform  Bleifrei lötbar, Lötpads vergoldet  gegurtet in 8mm Blistergurt, Kathode zur Transportperforation  Alle Bauteile in Intensitäts- und Farbklassen sortiert  Gurtung: Face-up (T)  Electro-Optical Characteristics (T=25°C) Elektrooptische Eigenschaften Parameter Emitting Color Farbe Forward Voltage Flussspannung Dominant Wavelength Dominante Wellenlänge FWHM Halbwertsbreite Luminous Intensity Lichtstärke Reverse Current Sperrstrom Copyright © 2014 OSA Opto Light GmbH. All Rights Reserved

Ceramics – high luminous intensity OCL-400 GE545  Maximum Ratings Grenzwerte Parameter Forward Current Flussstrom Forward Current, pulsed Flussstrom, gepulst Reverse Voltage Sperrspannung Reverse Current Sperrstrom Thermal Resistance Wärmewiderstand Operating Temperature Betriebstemperatur Storage Temperature Lagertemperatur Outline Drawing Zeichnung Recommended Soldering Pad Empfohlenes Lötpad Marking at anode Markierung an der Anode Copyright © 2014 OSA Opto Light GmbH. All Rights Reserved

Ceramics – high luminous intensity OCL-400 GE545  Performance Diagram Kennlinien 2 Forward Current vs. Forward Voltage Flussstrom über Flussspannung Intensity vs. Forward Current Strahlstärke über Flussstrom 1,0 Maximum Forward Current vs. Ambient Temperature Max. Flussstrom über Umgebungstemperatur View Angle Abstrahlung Copyright © 2014 OSA Opto Light GmbH. All Rights Reserved www.osa-opto.com edition 12/14 Page

Ceramics – high luminous intensity OCL-400 GE545  Soldering Conditions Lötprofile 300 10...20s IR reflow soldering profile for lead containing solder IR Reflow Lötprozess für bleihaltiges Lot IR reflow soldering profile for lead free soldering IR Reflow Lötprozess für bleifreies Lot Manual Soldering: Manuelles Löten: max power of iron 25W / 300°C for 3s Max. Leistung des Lötkolben 25W / 300°C für 3s Copyright © 2014 OSA Opto Light GmbH. All Rights Reserved www.osa-opto.com edition

Ceramics – high luminous intensity OCL-400 GE545  Ordering Code For Parts Kodierung der Bestellnummer Series Serie Color Farbe Encapsulation Verguss XD Type definition, e.g. Typenbezeichnung z.B. – uncolored diffused Tape And Reel Packing Gurt und Spule Copyright © 2014 OSA Opto Light GmbH. All Rights Reserved

Ceramics – high luminous intensity The reel is sealed in special plastic bag with integrate ESD protection ( MIL - STD 81705 ) including a silica dry-pack. MSL level acc. to IPC/JEDEC J-STD 020D: Level 2 for Europe Level 2a for all other countries Die Rolle wird zusammen mit einem Trockenmittelbeutel in einem HighshieldAntistatic-Beutel verschweißt. Feuchtigkeitsempfindlichkeitsschwellwert (MSL) gemäß J-STD 020D: Schwellwert 2 für Europa Schwellwert 2a für alle anderen Länder Label Etikett Order No. Bestellnr. Intensity group Intensitätsgruppe Quantity Anzahl Customer order No. Bestellnr....

Ceramics – high luminous intensity OCL-400 GE545 Attention please The information describes the type of component and shall not consider as assured characteristics. Terms of delivery and rights to change reserved. The data sheet may change without prior information; the valid issue will be on our webpage in internet. Due to technical requirements components may contain dangerous substances. Parameters can vary in different applications. All operating parameters must be validated for each customer application by the customer. OSA opto light GmbH does not have the responsibility for the...