Exhibit with us
*mydirectindustry  
English
  1. Catalogs
  2. OSA Opto
  3. OCL-400 GE545

OCL-400 GE545

OCL-400 GE545
1 / 7 PagesView full catalog

OCL-400 GE545

Product catalog summary
Features:
  • Dimensions: 3.0 x 2.0 x 1.0 mm
  • Circuit substrate: Al2O3 Ceramics
  • Encapsulation: Silicone
  • Color conversion type
  • ROHS and REACH compliant
  • Lead-free solderable with gold-plated soldering pads
  • Packaged in 8 mm blister tape, cathode aligned with transporting perforation
  • Devices sorted by luminous intensity classes
Electro-Optical Characteristics (T=25°C):
  • Emitting Color: Green
  • Forward Voltage (Uf): 3.10 - 3.70 V at If = 20 mA
  • Dominant Wavelength (λD): 540 - 550 nm at If = 20 mA
  • FWHM: 70 nm at If = 20 mA
  • Luminous Intensity (Iv): 710 - 900 mcd at If = 20 mA
  • Reverse Current (IR): 100 μA at UR = 5V
Maximum Ratings:
  • Forward Current (If, max): 30 mA
  • Forward Current, pulsed (If, pulse): 100 mA (tp≤100μs, τ=1:10)
  • Reverse Voltage (UR): 5 V
  • Thermal Resistance (Rth JA): 60 K/W
  • Operating Temperature (Top): -40 to +85 °C
  • Storage Temperature (TSt): -40 to +110 °C
Soldering Conditions:
  • IR reflow soldering profiles provided for both lead-containing and lead-free soldering
  • Manual soldering: Max power of iron 25W / 300°C for 3s
Ordering Code:
  • Series: OCL-400
  • Encapsulation and packaging options available
Packing:
  • Reel sealed in ESD-protected plastic bag with silica dry-pack
  • MSL level 2 for Europe, level 2a for other countries
LED Luminous Intensity Groups:
  • Groups range from 450 to 1800 mcd, with subgroups for finer selection
  • Measured according to CIE 127 with ±11% accuracy
Important Notes:
  • Information provided is not guaranteed; subject to change without notice
  • Components may contain hazardous substances
  • Customer responsible for validating operating parameters and long-term stability
  • Authorization required for use in toys, life support, or safety devices
See more

Catalog excerpts

OCL-400 GE545-1

Ceramics – high luminous intensity Features:  size 3,0(L) x 2,0(W) x 1,0(H) mm  circuit substrate: Al2O3 Ceramics  encapsulation: Silicone  color conversion type  devices are ROHS and REACH conform  lead free solderable, soldering pads: gold plated  taped in 8 mm blister tape, cathode to transporting perforation  all devices sorted into luminous intensity classes  taping: face-up (T) Merkmale:  Größe: 3.0 x 2.0 x 1.0 mm  Gehäusematerial: Al2O3 Keramik  Vergussmaterial: Silikon  Type mit Farbkonversion  Bauteile sind ROHS und REACH konform  Bleifrei lötbar, Lötpads vergoldet  gegurtet in 8mm Blistergurt, Kathode zur Transportperforation  Alle Bauteile in Intensitäts- und Farbklassen sortiert  Gurtung: Face-up (T)  Electro-Optical Characteristics (T=25°C) Elektrooptische Eigenschaften Parameter Emitting Color Farbe Forward Voltage Flussspannung Dominant Wavelength Dominante Wellenlänge FWHM Halbwertsbreite Luminous Intensity Lichtstärke Reverse Current Sperrstrom Copyright © 2014 OSA Opto Light GmbH. All Rights Reserved

 Open the catalog to page 1
OCL-400 GE545-2

Ceramics – high luminous intensity OCL-400 GE545  Maximum Ratings Grenzwerte Parameter Forward Current Flussstrom Forward Current, pulsed Flussstrom, gepulst Reverse Voltage Sperrspannung Reverse Current Sperrstrom Thermal Resistance Wärmewiderstand Operating Temperature Betriebstemperatur Storage Temperature Lagertemperatur Outline Drawing Zeichnung Recommended Soldering Pad Empfohlenes Lötpad Marking at anode Markierung an der Anode Copyright © 2014 OSA Opto Light GmbH. All Rights Reserved

 Open the catalog to page 2
OCL-400 GE545-3

Ceramics – high luminous intensity OCL-400 GE545  Performance Diagram Kennlinien 2 Forward Current vs. Forward Voltage Flussstrom über Flussspannung Intensity vs. Forward Current Strahlstärke über Flussstrom 1,0 Maximum Forward Current vs. Ambient Temperature Max. Flussstrom über Umgebungstemperatur View Angle Abstrahlung Copyright © 2014 OSA Opto Light GmbH. All Rights Reserved www.osa-opto.com edition 12/14 Page

 Open the catalog to page 3
OCL-400 GE545-4

Ceramics – high luminous intensity OCL-400 GE545  Soldering Conditions Lötprofile 300 10...20s IR reflow soldering profile for lead containing solder IR Reflow Lötprozess für bleihaltiges Lot IR reflow soldering profile for lead free soldering IR Reflow Lötprozess für bleifreies Lot Manual Soldering: Manuelles Löten: max power of iron 25W / 300°C for 3s Max. Leistung des Lötkolben 25W / 300°C für 3s Copyright © 2014 OSA Opto Light GmbH. All Rights Reserved www.osa-opto.com edition

 Open the catalog to page 4
OCL-400 GE545-5

Ceramics – high luminous intensity OCL-400 GE545  Ordering Code For Parts Kodierung der Bestellnummer Series Serie Color Farbe Encapsulation Verguss XD Type definition, e.g. Typenbezeichnung z.B. – uncolored diffused Tape And Reel Packing Gurt und Spule Copyright © 2014 OSA Opto Light GmbH. All Rights Reserved

 Open the catalog to page 5
OCL-400 GE545-6

Ceramics – high luminous intensity The reel is sealed in special plastic bag with integrate ESD protection ( MIL - STD 81705 ) including a silica dry-pack. MSL level acc. to IPC/JEDEC J-STD 020D: Level 2 for Europe Level 2a for all other countries Die Rolle wird zusammen mit einem Trockenmittelbeutel in einem HighshieldAntistatic-Beutel verschweißt. Feuchtigkeitsempfindlichkeitsschwellwert (MSL) gemäß J-STD 020D: Schwellwert 2 für Europa Schwellwert 2a für alle anderen Länder Label Etikett Order No. Bestellnr. Intensity group Intensitätsgruppe Quantity Anzahl Customer order No. Bestellnr. des...

 Open the catalog to page 6
OCL-400 GE545-7

Ceramics – high luminous intensity OCL-400 GE545 Attention please The information describes the type of component and shall not consider as assured characteristics. Terms of delivery and rights to change reserved. The data sheet may change without prior information; the valid issue will be on our webpage in internet. Due to technical requirements components may contain dangerous substances. Parameters can vary in different applications. All operating parameters must be validated for each customer application by the customer. OSA opto light GmbH does not have the responsibility for the reliability...

 Open the catalog to page 7

All OSA Opto catalogs and technical brochures

  1. OCI-450 IT755
    OCI-450 IT755

    7  Pages

  2. OCL-480 XE428
    OCL-480 XE428

    7  Pages

  3. OCL-490-20 GE565
    OCL-490-20 GE565

    7  Pages

  4. Products Epitaxial chips for use in optoelectronic devices
    Products Epitaxial chips for use in optoelectronic devices

    10  Pages

*Prices are pre-tax. They exclude delivery charges and customs duties and do not include additional charges for installation or activation options. Prices are indicative only and may vary by country, with changes to the cost of raw materials and exchange rates.